DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:215 Identity:61/215 - (28%)
Similarity:102/215 - (47%) Gaps:31/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ITFFVLANFTL-----ATFMDPG-IIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFY 107
            :||.:|...:|     .:.|||| :..:..|.|:.:||..|.:.:       .:.::.|..|...
  Rat    48 LTFLLLVLGSLLLYLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQ-------AIPLRRCRYCLVL 105

  Fly   108 RPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYV-LKIMP 171
            :|.|..||..|..|:..:||||||:.||:|.||:..|..:| :|.:.:| ::.|.|.:. |:...
  Rat   106 QPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVAYL-ALQLVVL-LWGLYLAWSGLQFFQ 168

  Fly   172 N----IKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGY------NP 226
            .    ::.|..:....|  |::..|:.:..|...|:.||:|..||.|.:: ..:..|      ||
  Rat   169 PWGLWLRSTGLLFTTFL--LLSFFALVVSLLLASHLYLVARNTTTWEFIS-SHRIAYLRQRTSNP 230

  Fly   227 FSRGCWHNCCYTQFGPQYPS 246
            |.||...|..:...|  :||
  Rat   231 FDRGPTRNLAHFFCG--WPS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 38/129 (29%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.