DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_038966311.1 Gene:Zdhhc18 / 362613 RGDID:1309334 Length:482 Species:Rattus norvegicus


Alignment Length:317 Identity:116/317 - (36%)
Similarity:168/317 - (52%) Gaps:53/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWIVLLL--TTFLFFFYPCQFYVK----SHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASP 73
            ||..:||:  ||.|||.:.|.:..:    :.|.:.|   ::.|||::.....:|.||||:|:|:.
  Rat    92 FALTLLLILSTTILFFIFDCPYLARTLTLAIPIIAA---ILFFFVMSCLLQTSFTDPGILPRATI 153

  Fly    74 DEDCEEELR-----------APLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDH 127
            .|....|.:           .|..:...|||..||:|:|.|||.:||||.||||||::|:|.|||
  Rat   154 CEAAALEKQIDNTGSSTYRPPPRTREVMINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDH 218

  Fly   128 HCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPN-------IKDTAPIVAIILM 185
            |||||.||:||||||||:.|::|||.....||: |:|..|.::..       :|.|...|..:::
  Rat   219 HCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFA-CVVTHLTLLSQGSNFLSALKKTPASVLELVI 282

  Fly   186 GLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKF---KGG---YNPFS-RGCWHNCCYTQFGPQ 243
            ...:|.:  |.||:|||..||:...||||.:.|.:   :||   .||:| :....|||....||.
  Rat   283 CFFSIWS--ILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPL 345

  Fly   244 YPSLLNPKKYASRRSQVQNQAI--STICNDRSGQQTGAGSGAGGNGTAAVSGGGGGV 298
            .|||::      ||..||:..:  |.|.:|.        ...|....|:::.|..||
  Rat   346 PPSLID------RRGFVQSDTVLPSPIRSDE--------PACGAKPDASMAPGLRGV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 62/131 (47%)
Zdhhc18XP_038966311.1 DHHC 189..312 CDD:396215 60/125 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.