DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Patsas

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:121/263 - (46%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KTRYIPA---TFAW-----------IVLLLTTFLFFFYPCQFYVKSHP--WVLAYQGVITFF--- 52
            |:|:||:   ::.|           :.|.|.:.|.:.|| .:.:::.|  |.:..:....|.   
  Fly   343 KSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYP-MYMIRAIPITWNILRRSHYCFIYWN 406

  Fly    53 --VLANFTLATFMDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHC 115
              :..::.:|...|||.||.:| |.......:.|.:...:...:.: .:.|.:|:..||.|..||
  Fly   407 AVMWISWAIANRRDPGYIPLSS-DAYYRAIKQIPYFDKLKKRNVML-TRLCHSCRCLRPLRAKHC 469

  Fly   116 SVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIH-MLSIFSLC---------LVYVLKIM 170
            .|||.|:..||||||::.||:|.||..:||.|::|:::: ..:|:..|         ::|||.: 
  Fly   470 RVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIEGFTMLYVLGL- 533

  Fly   171 PNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGK-------FKGGY-NPF 227
                    |.|::..||..|       ||...::......||||....|       .:|.| |||
  Fly   534 --------IEAVVFCGLGWI-------LTCTSILHACMNLTTNEMFNYKRYPYLRDKRGRYQNPF 583

  Fly   228 SRG 230
            |||
  Fly   584 SRG 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/134 (31%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 42/127 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.