DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:250 Identity:68/250 - (27%)
Similarity:101/250 - (40%) Gaps:62/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWI--VLLLTTFLFFFYPCQFYVKSH-PWVLAYQGVITFFVLANFTL-----ATFMDPGIIPKA 71
            |.|:  ::|:...:.|    ..|.:.| |.:|    :|.|:.::.|.|     |:..|||.:|:.
Human    22 FVWLYNIVLIPKIVLF----PHYEEGHIPGIL----IIIFYGISIFCLVALVRASITDPGRLPEN 78

  Fly    72 SPDEDCEEELRAPLYKNAEINGITVKMKW--CVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNN 134
            ......|.|.                  |  |..|...||.|..|||.|.||:...||||||:||
Human    79 PKIPHGEREF------------------WELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINN 125

  Fly   135 CIGRRNYRFFF---FFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVA----IILMGLVTILA 192
            |:|..|:..|.   |:...|:.:.| :||.|..|.  .:|..|....:..    :.:|.|...:.
Human   126 CVGEDNHWLFLQLCFYTELLTCYAL-MFSFCHYYY--FLPLKKRNLDLFVFRHELAIMRLAAFMG 187

  Fly   193 IP-IFGLTG-FHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245
            |. :.|:|| |:..|:  |..|:.....|..            |||.....|:.|
Human   188 ITMLVGITGLFYTQLI--GIITDTTSIEKMS------------NCCEDISRPRKP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 43/135 (32%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.