DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and pfa5

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:38/159 - (23%)
Similarity:61/159 - (38%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCL 163
            :.|.|||.:.|.|..|..|...||..|||:|.:|...:...|.:||:.||      .....:.|:
pombe   113 RMCGTCKCWLPDRSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFL------FYGFSAACM 171

  Fly   164 VYVLKIMPNIKDTAPIVAII-----LMGL-VTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKG 222
            |.:        .||.:::..     |.|. :.:|....||:....::||..        ||....
pombe   172 VLI--------STAIMISRTYHYRSLPGTWIFVLVFSAFGVLFLGVMLVRH--------TGYLLL 220

  Fly   223 GYNPFSRGCWHNCCYTQFGPQYPSLLNPK 251
            ..|......|....|: |...:|..::.:
pombe   221 NINSHEAKNWKTRIYS-FSVFFPEHMDSR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 32/125 (26%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.