DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:212 Identity:56/212 - (26%)
Similarity:80/212 - (37%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KASPDEDCEEELRAPLYKNAEINGIT---------VKMKWCVTCKFYRPPRCSHCSVCNHCIETF 125
            |..|..|....|.....|: ::.|.:         ||..||..|:..||.|..||.:|..|:...
Mouse   212 KGFPGTDASGSLNNRTLKD-DVRGSSRVGLDSPAKVKEDWCAKCQLVRPARAWHCRICGICVRRM 275

  Fly   126 DHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPN--IKDTAPIVA------- 181
            ||||.|:|:|:|..|::.|        |..||||.|..||.:.:..|  .:|.:...|       
Mouse   276 DHHCVWINSCVGESNHQAF--------ILALSIFLLTSVYGISLTLNTICRDRSLFTALFYCPGV 332

  Fly   182 -----------------IILMGLVTILAIPI----FGLTGFHMVLVSRGRTTNEQVTGKF--KGG 223
                             ||..|:..|..|.:    :.:|...:....|.:|....:.|..  .|.
Mouse   333 YANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQ 397

  Fly   224 YNPFSRGCWHNCCYTQF 240
            ||   ||...|  :.||
Mouse   398 YN---RGFLRN--WLQF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 41/163 (25%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 37/133 (28%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.