DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Ankle2

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_573221.2 Gene:Ankle2 / 32732 FlyBaseID:FBgn0028343 Length:1174 Species:Drosophila melanogaster


Alignment Length:213 Identity:43/213 - (20%)
Similarity:80/213 - (37%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 VMASPVRRSNPGTPTQPRRPDFIGLNAQAVAQQQQQQQQAAAAAAAAYYEYTSGLPPQHPQAPSI 569
            :.|..::.|||.:.:..     :...:.:.:....|...|...:||..|| ....||..|.....
  Fly    28 IAAVNIKPSNPASGSAS-----VASGSPSGSAASVQTGNADDGSAATKYE-DPDYPPDSPLWLIF 86

  Fly   570 QQQQQQLLLQQQRVLMQHQQQQQALQQQQQQQQQAAVHAAHPQHAALAQ---------------- 618
            .::.:.|      .:::|.::.:..:....:|.::.|........||.:                
  Fly    87 TEKSKAL------DILRHYKEARLREFPNLEQAESYVQFGFESIEALKRFCKAKPESKPIPIISG 145

  Fly   619 AAYGGSPQRRFLSEGELVRQGAGGGVAGGELSYARSNNTVDNIRELAGSPQRGVYMWKDTSPGFT 683
            :.|..||..   ::........|.|  .|.:....||:::.|:. |:.||        .:||..:
  Fly   146 SGYKSSPTS---TDNSCSSSPTGNG--SGFIIPLGSNSSMSNLL-LSDSP--------TSSPSSS 196

  Fly   684 NNA---GQQQQQQQQAQQ 698
            :|.   |:|||.|||.||
  Fly   197 SNVIANGRQQQMQQQQQQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823
Ankle2NP_573221.2 ANK repeat 280..335 CDD:293786
Ank_2 281..361 CDD:403870
ANK repeat 337..369 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12349
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.