DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and zdhhc6

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001191086.1 Gene:zdhhc6 / 324468 ZFINID:ZDB-GENE-030131-3189 Length:412 Species:Danio rerio


Alignment Length:207 Identity:60/207 - (28%)
Similarity:87/207 - (42%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GVITFFVLANFTL--------ATFMDPGIIP---KASPDEDCEEELRAPLYKNAEINGITVKMKW 100
            |.|.|.:|.|:|:        |.|:.||.||   |....:|.       :|           :::
Zfish    54 GSINFIMLINWTVLILYNYFNAMFVGPGYIPLEWKPEKQQDI-------MY-----------LQF 100

  Fly   101 CVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFF--FFFLVSLS-IHMLSIFSLC 162
            |..|:.|:.||..||..||.|:...||||||:|||.|..|:.:|  |..|..|. ||...||.:.
Zfish   101 CRLCQGYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHLNHAYFTSFLLLAPLGCIHAALIFIMT 165

  Fly   163 LVYVL-----------------------KIMP-NIKDTAPIVAIILMGLVTILAIPIFGLTGF-H 202
            :...|                       .||| :|...|..:..:.:.|.|.:|:   |:..| .
Zfish   166 MYTQLYDRISFGWSSVKIDMSAARHIHHPIMPFSIAAFAATLFALGLALGTTIAV---GMLFFIQ 227

  Fly   203 MVLVSRGRTTNE 214
            |.::.|.||:.|
Zfish   228 MKVILRNRTSIE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 45/149 (30%)
zdhhc6NP_001191086.1 DHHC 95..241 CDD:396215 46/166 (28%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 409..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.