DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc17

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_766142.2 Gene:Zdhhc17 / 320150 MGIID:2445110 Length:632 Species:Mus musculus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:112/271 - (41%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDC 77
            ||..|  :.:|.|.:|:....|.....|::.  ..|..|:   ||..:...||||| ||:     
Mouse   365 ATKFW--MYVTWFFWFWNDLNFLFIHLPFLA--NSVALFY---NFGKSWKSDPGII-KAT----- 416

  Fly    78 EEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYR 142
            ||:.:..:.:.||...:.:.: :|.||...:|.|..||.|||.||..||||||||.||:|..|:|
Mouse   417 EEQKKKTIVELAETGSLDLSI-FCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR 480

  Fly   143 FFFFFLVSLSIHMLSIFSLC-LVY------------------VLKIMPNIKDTAPIVAIILMGLV 188
            :|..:|..|      :|.:| ::|                  ....:..|...:|.:..:.:..|
Mouse   481 YFMGYLFFL------LFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSV 539

  Fly   189 TILAIPIFGLTGFHMVLVS------------RGRTTNEQVTGK----FK----GGYNPFSRGCWH 233
                        ||.:.|:            .|.||||::..:    ||    ...:||:.||..
Mouse   540 ------------FHFLWVAVLLMCQLYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVR 592

  Fly   234 N--------CC 236
            |        ||
Mouse   593 NIIDFFEFRCC 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/155 (27%)
Zdhhc17NP_766142.2 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000269|PubMed:25253725 11..305
ANK repeat 89..120 CDD:293786
PHA03095 100..>352 CDD:222980
ANK repeat 122..154 CDD:293786
ANK repeat 156..187 CDD:293786
Ank_2 161..255 CDD:372319
ANK repeat 189..221 CDD:293786
ANK repeat 224..255 CDD:293786
DHHC 438..568 CDD:366691 42/147 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.