DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:260 Identity:71/260 - (27%)
Similarity:114/260 - (43%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIPATFAWIVLLLTTFLFFFYPCQFYVKSHP----WVLAYQGVITFFV----LANFTLATFMDPG 66
            ::|.....:|:|.:.:.:.|..|...|.|..    :::.|..:..||.    .:.|||       
  Rat    22 WVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAWTYWKSIFTL------- 79

  Fly    67 IIPKASPDE-------DCEEELRAPLYKNAEINGITVKM-------------------KWCVTCK 105
              |: .|::       |.|.      |||.|...:..:|                   ::|..|.
  Rat    80 --PQ-QPNQKFHLSYTDKER------YKNEERPEVQKQMLVDMAKKLPVYTRTGNGAVRFCDRCH 135

  Fly   106 FYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKI- 169
            ..:|.||.|||||..|:...||||||||||||..||:||..||....::.|.|.:....|.:|. 
  Rat   136 LIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYW 200

  Fly   170 ---MPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQ------VTGKFKGGYN 225
               :|:::....::.::.:..:..:::.|  |.|:|..||||.:||.|.      .:|..|.|:|
  Rat   201 RGELPSVRSKFHVLFLLFVACMFFVSLVI--LFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFN 263

  Fly   226  225
              Rat   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/153 (30%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 49/141 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.