DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:286 Identity:74/286 - (25%)
Similarity:114/286 - (39%) Gaps:69/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDC 77
            |.:.:.|......|.|..||...    |:||....::.      |||....:||.|.|.:     
  Rat    81 AEYTYEVFSYCRELEFSLPCLLL----PYVLLSVNLVF------FTLTCSTNPGTITKTN----- 130

  Fly    78 EEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYR 142
             ..|...:|:..|:  :..|...|.||...:|.|..||.||:.|:..|||||.|||||||..|..
  Rat   131 -VLLLLQVYEFDEV--MFPKNSRCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTG 192

  Fly   143 FFFFFLVSLSIHMLSIFSLCLVYVLKIMP----------------NIKDTAPIV---------AI 182
            :|..:|::|:....:|..|...::|:::.                ...||..::         .|
  Rat   193 YFLIYLLTLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGFLIQHLFLAFPRII 257

  Fly   183 ILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGY---------------------NP 226
            .|:|.|.:|::.:.|...|.:.|.:..:||||.    ::|.:                     |.
  Rat   258 FLLGFVIVLSLLLAGYLCFALYLAATNQTTNEW----YRGDWAWCQHWPLVAWSPSAEPQIHQNI 318

  Fly   227 FSRGCWHNCCYTQFGPQYPSLLNPKK 252
            :|.|.|.| ....|.|..||....|:
  Rat   319 YSHGLWSN-LQEVFIPATPSYKKKKR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 44/149 (30%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 43/144 (30%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.