DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:281 Identity:108/281 - (38%)
Similarity:161/281 - (57%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLLLTTFLFFFYPCQFY-VKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDC--EEE 80
            ::|.|..|||.:.|::. |:..|.:..:..::..|.:|.....:|.|||:||:|.|||..  |.|
  Rat    44 LILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEME 108

  Fly    81 LRA------------PLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVN 133
            :.|            |..||.:||...||:|:|.|||.:||||.||||:|::|:|.||||||||.
  Rat   109 IEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVG 173

  Fly   134 NCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYV----LKI--MPNIKDTAPIVAIILMGLVTILA 192
            ||:|:||||:|:.|::|||:..:.:|:..:|||    |||  :..:|:|...|..:|:...|:.:
  Rat   174 NCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWS 238

  Fly   193 IPIFGLTGFHMVLVSRGRTTNEQVTGKFKGG---YNPFSRG-CWHNCCYTQFGPQYPSLLNPK-- 251
              :.||||||..||:..:||||.:.|.:.|.   .||:|.| ...|||....||..||:|:.:  
  Rat   239 --VVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGI 301

  Fly   252 ----KYASRRSQVQNQAISTI 268
                :..||....|..:.|.:
  Rat   302 LPLEESGSRPPSTQETSSSLL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 62/130 (48%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 60/124 (48%)
ANXA2R <284..>343 CDD:292349 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.