DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:334 Identity:86/334 - (25%)
Similarity:132/334 - (39%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFF---YPCQFYVKSHPWVLAYQGVI----TFFVLANFTLATFMDPGIIPK 70
            |...|.::|...|:..|   .|.:.|..|     ...|::    .|..||:...|...|||.:||
  Rat    48 AIVTWFLVLYAEFVVLFVMLIPSRDYAYS-----IINGIVFNLLAFLALASHCRAMLTDPGAVPK 107

  Fly    71 ASPDEDCEEELRAP----LYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPW 131
            .:..::..|.|:..    :||             |..|...:|.|..|||||..||...||||||
  Rat   108 GNATKEFIESLQLKPGQVVYK-------------CPKCCSIKPDRAHHCSVCKRCIRKMDHHCPW 159

  Fly   132 VNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLV--YVLKIM----PNIKDTAPIVAIILMGLVTI 190
            ||||:|..|.::|..|  ::.|.::|:.:|.:|  :.|...    ......:|...:||:.|:..
  Rat   160 VNNCVGENNQKYFVLF--TMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCF 222

  Fly   191 LAI-------PIFGLTGFHMVL--------VSRGRTTNEQVTGKFK------GG------YNPFS 228
            .|:       .:|| |..|.:.        :.|.:...|| :|.:|      ||      :|||:
  Rat   223 EALLFLIFTSVMFG-TQVHSICTDETGIERLQRSKQPREQ-SGSWKSVQEAFGGEFSLNWFNPFT 285

  Fly   229 RGCWHNCCYTQFGPQYP----------SLLNPKKYASRRSQV----------QNQAISTICNDRS 273
            |.|         .|:.|          ||.|.....:...|:          ::|....:|:.|:
  Rat   286 RPC---------QPEIPIDKGLVRQVSSLSNMDNVETAEGQLEETKDRDPVEEDQVQCELCHIRA 341

  Fly   274 GQQTGAGSG 282
            |     |||
  Rat   342 G-----GSG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/145 (29%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.