DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:252 Identity:86/252 - (34%)
Similarity:127/252 - (50%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIPATFAWIVLLLTTF---LFFFYPCQFYVKSHPWVL-AYQG---VITFFVLANFTLATFMDPGI 67
            :.|:.||...:.|..|   |||.:||::.|::..||. |..|   ::|||.|.:.   .|.||||
  Rat    28 FFPSLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPAVTGPLFILTFFSLVSL---NFSDPGI 89

  Fly    68 IPKASPDEDCEEELRAPLYKN-AEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPW 131
            :.:.|..||       |...: ..:|....:::||..|.|:||||..||..||.|:|.|||||.|
  Rat    90 LHRGSVSED-------PRTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKW 147

  Fly   132 VNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKI--MPNIKDTAP--IVAIILMGLVTILA 192
            ||||||.||:|.|...::.|.::..::...||::::..  :|...|.|.  :||:...|.:    
  Rat   148 VNNCIGHRNFRLFVLLILFLCLYSGALLVTCLMFLIHTSHLPFSLDKAMAILVAVPAAGFL---- 208

  Fly   193 IPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGC---WHNCCYTQFGPQYPS 246
            ||:|.|.....:.|||...:.|......: .||||.:|.   |:.......||.|.|
  Rat   209 IPLFLLMLIQALSVSRAERSYESKCRDHE-EYNPFDQGFAKNWYLTMCAPLGPNYMS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 47/128 (37%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 46/121 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.