DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:224 Identity:55/224 - (24%)
Similarity:92/224 - (41%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LANFTLATFM-DPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSV 117
            ||.|.|...: :.|:..::.|      .:|..:...   .|:.....:|..|:...|||..|||.
Human    57 LAAFQLLNLLGNVGLFLRSDP------SIRGVMLAG---RGLGQGWAYCYQCQSQVPPRSGHCSA 112

  Fly   118 CNHCIETFDHHCPWVNNCIGRRNYRFFFFFLV---SLSIHMLSIFSLCLVYVLKIMPNIKDTAPI 179
            |..||...||||..:..|:|..|||.|...|:   .:.:|:..:....|..:|:....:...|.:
Human   113 CRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALL 177

  Fly   180 V---AIILMGLVTILAIPIFGLTG--------------FHMVLVSRGRTTNEQVTGKFKGGYNPF 227
            :   .::|.|.|::....:..:|.              ||.:|:.||:||.|...|:     :.:
Human   178 LLPWLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQ-----HSY 237

  Fly   228 SRGCWHNCCYTQFGPQ------YPSLLNP 250
            ..|..|| .....||:      :|.|.:|
Human   238 DLGPCHN-LQAALGPRWALVWLWPFLASP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 38/144 (26%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.