DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and erf2

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:283 Identity:81/283 - (28%)
Similarity:127/283 - (44%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCDVKTRYIPATFAWIVLLLTTFLFFFYPCQFYVKSH-----PWVLAYQGVITFFVLANFTLATF 62
            :..:.::|.....:...|:|...|||.:.. |::..|     |...||  :....|::.|..:| 
pombe    77 RLQMSSQYKAFLISLFALILPGVLFFIFSA-FWLWHHVSPAVPITFAY--LYALAVVSMFKCST- 137

  Fly    63 MDPGIIPK---------ASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVC 118
            .||||:|:         |.|.....|: |..|..:...:.:.|...:|.||..|||||.|||.:|
pombe   138 ADPGILPRNAYSLTYNPAHPWSVIPED-RKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASHCHLC 201

  Fly   119 NHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDT------- 176
            ::|:|..||||.|:|.||||||||::|.||:|:.:..|.:..|.....:.......||       
pombe   202 DNCVEYLDHHCIWLNTCIGRRNYRYYFIFLLSVVLSALYLTGLGFYTSIGSFHESTDTNFAAHLR 266

  Fly   177 APIVAI-ILMGLVTILAIPIFG-LTGFHMVLVSRGRTTNEQVTGKF--KGGYNPFSRGCWHNCCY 237
            .|...: ..:|:...|...:.| |..:...|:|.|:..:|.:..|.  ....:||....|.|...
pombe   267 RPWAGVSFFLGIYGALGAILPGILFCYQCYLISVGQNVHEYLRAKSTETEDVHPFHDSIWLNFLV 331

  Fly   238 TQFGPQYPSLLNPKKYASRRSQV 260
            ....|:..|.:.|    :|:|.|
pombe   332 VLCRPKNVSYVRP----TRKSYV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/133 (35%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 80/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 1 1.000 - - otm47361
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.