DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and swf1

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_596556.1 Gene:swf1 / 2539719 PomBaseID:SPBC13G1.07 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:70/254 - (27%)
Similarity:108/254 - (42%) Gaps:70/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRYIPATFAWIVLLLTTFLFFFYPCQFYVKSHPWV------LAYQGVITFFVLANFTLATF---- 62
            :||.....:..:..|:.::.:        |::|.|      |...|:.:||:..:.....|    
pombe    54 SRYADGRCSAAMRSLSNYVLY--------KNNPLVVFLYLALITIGIASFFIYGSSLTQKFSIID 110

  Fly    63 ----MDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMK-W------------------CVTC 104
                :...::|..|            ||..|:.|...:.:| |                  |.||
pombe   111 WISVLTSVLLPYIS------------LYIAAKSNPGKIDLKNWNEASRRFPYDYKIFFPNKCSTC 163

  Fly   105 KFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVY---V 166
            ||.:|.|..||.:||.|:|.|||||.|:|||:|..|.|:||.||: .:|.:|....|.|.|   .
pombe   164 KFEKPARSKHCRLCNICVEKFDHHCIWINNCVGLNNARYFFLFLL-CTIQLLFHSILRLGYHFNA 227

  Fly   167 LKIM---PN--------IKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNE 214
            |:.|   |:        ||....:.::.|:.|  |.::.:..|.|:...||..|.||||
pombe   228 LRDMRQYPSFLRSWWFAIKSEGELGSVFLISL--ICSVLVLCLLGYEFFLVYAGYTTNE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 53/154 (34%)
swf1NP_596556.1 COG5273 47..356 CDD:227598 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2106
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.