DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:235 Identity:57/235 - (24%)
Similarity:92/235 - (39%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PATFAWIVLLLTTF---LFFFYPCQFYVKSHPWV------LAYQGVITFFVLANFTLATFMDPGI 67
            ||.|  :.:.|.||   ||.|.|.   ::..|..      ....|.:..|:.|| .|..::   :
Mouse    12 PAYF--LCISLVTFVLQLFLFLPS---MREDPTATPLFSPAVLHGALFLFLSAN-ALGNYV---L 67

  Fly    68 IPKASPDE--DCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSH-CSVCNHCIETFDHHC 129
            :.:.|||:  .|:              |...:...|       ||..:| |.||:......||||
Mouse    68 VIQNSPDDLGTCQ--------------GTMSQRPQC-------PPPSTHFCRVCSRVTLRHDHHC 111

  Fly   130 PWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILM--------- 185
            .:..||||.||.|.|..|.:..|:..|......:.|:..:: :|....|:..:.|:         
Mouse   112 FFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVL-SISFAHPLAFLTLLPTSISQFFS 175

  Fly   186 ------GLVTILAIPIF---GL--TGF---HMVLVSRGRT 211
                  .:..||.:.::   ||  .||   .::|:.||:|
Mouse   176 GAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRGQT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 36/142 (25%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 34/126 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.