DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:481 Identity:145/481 - (30%)
Similarity:218/481 - (45%) Gaps:108/481 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVLLLTTFLFFFYPCQFYV-KSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDE--DCEE 79
            |::|:|:.|||.:.|::.. |..|.:....|::.|||:......:|.|||::|:|:|||  |.|.
Mouse    69 ILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLER 133

  Fly    80 EL------------RAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWV 132
            ::            ..|..|...|||.|||:|:|.|||.:||||.||||:|::|:|.||||||||
Mouse   134 QIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQFDHHCPWV 198

  Fly   133 NNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLK------IMPNIKDTAPIVAIILMGLVTIL 191
            .||:|:||||||:.|::|||...:.||:..:.:|:.      .:..:||:.   |.:|..::...
Mouse   199 GNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVIHRSQQKGFLDALKDSP---ASVLEAVICFF 260

  Fly   192 AI-PIFGLTGFHMVLVSRGRTTNEQVTGKF-----KGGYNPFSRG-CWHNCCYTQFGPQYPSLLN 249
            :: .|.||:|||..|:|..:||||.:.|.:     |..|||:|.| .:.|||....||..|||::
Mouse   261 SVWSIIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYNPYSYGNIFTNCCVALCGPISPSLID 325

  Fly   250 PKKYASRRSQVQNQAISTICNDRSGQQTGAGSGAGGNGTAAVSGGGGGVGSGGGMRGTAVQYSPR 314
                  ||..||...          .|..|.|                       .|..:..:.:
Mouse   326 ------RRGYVQPDT----------PQPAAPS-----------------------NGITMYGATQ 351

  Fly   315 SFYDASREKRGIQVKTYM--AEGNGYNQRSGSTTLYSKLSPGRECSDTDLEPPPASQSQDCEPTP 377
            |..|...:.:.||...::  |......|...|.|......||:    ..|..|.||.:.. :|||
Mouse   352 SQSDMCDQDQCIQSTKFVLQAAATPLLQSEPSLTSEELHMPGK----PGLGTPCASLTLG-QPTP 411

  Fly   378 PLQRHNSSSFYLPQVSDSGGLNGSVSTGGGGGGDSPRHMRLYHPRHSPHARPRGLDPQRGYTSDA 442
            |      ||  :|.::....|:..:                  |....|...:.|.|     .:|
Mouse   412 P------SS--MPNLATEATLSDIM------------------PLKDEHGGHQFLTP-----DEA 445

  Fly   443 LSPDHPVGYGVGVNGSQQQQQQALAA 468
            .||...:|.|..:..|:......||:
Mouse   446 PSPPRMLGAGSPLAHSRTMHMLGLAS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 59/131 (45%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 56/127 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.