Sequence 1: | NP_001259382.1 | Gene: | Zdhhc8 / 31887 | FlyBaseID: | FBgn0085478 | Length: | 1052 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024514.2 | Gene: | dhhc-14 / 181109 | WormBaseID: | WBGene00044071 | Length: | 565 | Species: | Caenorhabditis elegans |
Alignment Length: | 282 | Identity: | 74/282 - (26%) |
---|---|---|---|
Similarity: | 124/282 - (43%) | Gaps: | 73/282 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RYIP---ATFAWIV--LLLTTFLFFFYP--------------------------CQFYVKSHPWV 42
Fly 43 LAYQGVITFFVLANFTLATF--MDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCK 105
Fly 106 FYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVY--VLK 168
Fly 169 IMPN------IKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKG----- 222
Fly 223 ----GYN------PFSRGCWHN 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zdhhc8 | NP_001259382.1 | zf-DHHC | 94..219 | CDD:279823 | 41/132 (31%) |
dhhc-14 | NP_001024514.2 | ANK | 19..143 | CDD:238125 | |
Ank_2 | 30..120 | CDD:289560 | |||
ANK repeat | 55..87 | CDD:293786 | |||
ANK repeat | 89..120 | CDD:293786 | |||
Ank_2 | 94..222 | CDD:289560 | |||
ANK | 117..244 | CDD:238125 | |||
ANK repeat | 190..222 | CDD:293786 | |||
PulO | <261..>367 | CDD:224900 | 18/82 (22%) | ||
zf-DHHC | 394..521 | CDD:279823 | 41/130 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |