DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:286 Identity:94/286 - (32%)
Similarity:140/286 - (48%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIPATF-AWIVLLLTTF--LFFFYPCQFYVKSHPWVLAYQGVIT--FFVLANFTLAT--FMDPGI 67
            ::|:.| |:.|:||..|  |||.:||::..::..|...   |||  .|||..|:|.:  |.||||
Human    25 FLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFP---VITGSLFVLTFFSLVSLNFSDPGI 86

  Fly    68 IPKASPDEDCEEELRAPLYKNAE-INGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPW 131
            :.:.|.::       .||..:.. :|....:::||..|.|:||||..||..||.|:|.|||||.|
Human    87 LHQGSAEQ-------GPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKW 144

  Fly   132 VNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKI--MPNIKDTAPIVAIILMGLVTILAIP 194
            ||||||.||:|||...::||.::..::...||:::::.  :|...|.|  :||::......|.:|
Human   145 VNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHLPFSTDKA--IAIVVAVSAAGLLVP 207

  Fly   195 IFGLTGFHMVLVSRGRTTNEQVTGKFKG------GYNPFSRGC---WHNCCYTQFGPQY------ 244
            :..|.....:.||....|       :||      |||||.:||   |:.......||:|      
Human   208 LSLLLLIQALSVSSADRT-------YKGKCRHLQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQ 265

  Fly   245 --------------------PSLLNP 250
                                ||.|||
Human   266 LQRVVGPDWTSMPNLHPPMSPSALNP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/126 (37%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 35/71 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.