DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:279 Identity:76/279 - (27%)
Similarity:120/279 - (43%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFF---YPCQFYVKSHPWVLAYQGVITFFVLANFTLATFM-----DPGIIP 69
            |...|::::...|:..|   .|.:.:     |.....||: |..||...|::.:     |||.:|
Mouse    51 AVMTWLLVVYADFVVTFVMLLPSKDF-----WYSVVNGVL-FNCLAVLALSSHLRTMLTDPGAVP 109

  Fly    70 KASPDEDCEEELRAP----LYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCP 130
            |.:..::..|.|:..    :||             |..|...:|.|..|||:|..||...|||||
Mouse   110 KGNATKEYMESLQLKPGEVIYK-------------CPKCCCIKPERAHHCSICKRCIRKMDHHCP 161

  Fly   131 WVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIM----PNIKDTAPIVAIILM------ 185
            |||||:|.:|.|||..|.:.:::..:....||.:..:..:    ....|.:|.:.:||:      
Mouse   162 WVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLE 226

  Fly   186 GLV--TILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGC-WHNCCYTQFGPQYPSL 247
            ||:  |..|: :|| |..|.:      ..:|....:.|.....:.|.. |........||  |||
Mouse   227 GLLFFTFTAV-MFG-TQIHSI------CNDETEIERLKSEKPTWERRLRWEGMKSVFGGP--PSL 281

  Fly   248 L--NP-KKYASRRSQVQNQ 263
            |  || ..:..||.|::.:
Mouse   282 LWMNPFVGFRLRRLQMRTR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 41/136 (30%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 43/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.