DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and zdhhc13

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_002942880.3 Gene:zdhhc13 / 100493145 XenbaseID:XB-GENE-997024 Length:612 Species:Xenopus tropicalis


Alignment Length:294 Identity:83/294 - (28%)
Similarity:120/294 - (40%) Gaps:73/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYIPA-TFAWIV--LLLTTFLFFFYPCQFYVKSHPWV--LAYQ--GVITFFVLANFTLATF-MDP 65
            |.:|| .|:..:  :.||.|::|.          |.:  :|:|  .:|:..:|..|...|: .||
 Frog   335 RSLPAIIFSCCIFWMFLTWFIYFL----------PGLARVAFQLPFIISMLLLFYFFYKTWCTDP 389

  Fly    66 GIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCP 130
            |.| |:|     |||.|..:...||...:..:: :|.:|...:|.|..||..||.|:..||.||.
 Frog   390 GYI-KSS-----EEESRQTIITLAEAGCLDARL-FCTSCLVKKPLRSMHCHACNSCVARFDQHCV 447

  Fly   131 WVNNCIGRRNYRFFFFFLVSLSI---------------H------------MLSIFSLCLVYVLK 168
            |...|||..|..||..||.||::               |            .||....|..:||.
 Frog   448 WTGQCIGAGNQHFFVLFLASLAVVGNWMIYATSVYWSDHCGMGSRKDGIWATLSQIVNCSPWVLY 512

  Fly   169 IMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMV-LVSRGRTTNEQVTGKFKGGYNPFSRGCW 232
            |...:  :|..|...||.||.:..|...|||....: |..:.|....||:.:    ..||:|||.
 Frog   513 IFCLV--SAFTVWATLMLLVQLFQISFLGLTTQERISLQVQNRHLKHQVSLR----RTPFNRGCL 571

  Fly   233 HN------C-CY-------TQFGPQYPSLLNPKK 252
            .|      | |:       ..:..||...:.|.:
 Frog   572 QNLADFFHCQCFGLIKSQPIDWTKQYHGAIPPSR 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 45/152 (30%)
zdhhc13XP_002942880.3 Ank_2 46..136 CDD:372319
ANK repeat 71..102 CDD:293786
PHA03095 82..>246 CDD:222980
ANK repeat 104..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 171..237 CDD:293786
DHHC 327..>549 CDD:388695 68/232 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.