powered by:
Protein Alignment CG31644 and cox6c
DIOPT Version :9
Sequence 1: | NP_001285640.1 |
Gene: | CG31644 / 318868 |
FlyBaseID: | FBgn0051644 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012820048.2 |
Gene: | cox6c / 496600 |
XenbaseID: | XB-GENE-1001882 |
Length: | 112 |
Species: | Xenopus tropicalis |
Alignment Length: | 33 |
Identity: | 12/33 - (36%) |
Similarity: | 17/33 - (51%) |
Gaps: | 0/33 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 PRKRKYRNFYSTYDPMDAFDRMMSGGYLSSCPP 78
||||.|.::|..:|.|..::.|...|...|..|
Frog 77 PRKRAYADYYKNFDSMKEYEAMREAGVFQSVRP 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1618740at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006275 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.