DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31644 and cox6c

DIOPT Version :9

Sequence 1:NP_001285640.1 Gene:CG31644 / 318868 FlyBaseID:FBgn0051644 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_012820048.2 Gene:cox6c / 496600 XenbaseID:XB-GENE-1001882 Length:112 Species:Xenopus tropicalis


Alignment Length:33 Identity:12/33 - (36%)
Similarity:17/33 - (51%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PRKRKYRNFYSTYDPMDAFDRMMSGGYLSSCPP 78
            ||||.|.::|..:|.|..::.|...|...|..|
 Frog    77 PRKRAYADYYKNFDSMKEYEAMREAGVFQSVRP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31644NP_001285640.1 Cyt_c_Oxidase_VIc 9..76 CDD:238467 10/29 (34%)
cox6cXP_012820048.2 COX6C 38..107 CDD:397198 10/29 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1618740at2759
OrthoFinder 1 1.000 - - FOG0006275
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.