DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31644 and Y111B2A.2

DIOPT Version :9

Sequence 1:NP_001285640.1 Gene:CG31644 / 318868 FlyBaseID:FBgn0051644 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001379273.1 Gene:Y111B2A.2 / 176675 WormBaseID:WBGene00013728 Length:86 Species:Caenorhabditis elegans


Alignment Length:72 Identity:19/72 - (26%)
Similarity:35/72 - (48%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDRM-----MSGGYLSSCPPGSGP 82
            |.:.::..:|:::...|...:..||..||..|::.|||   :.||     .:.||:.:||.....
 Worm    13 RGIYVSLAVAVVSTAAFNAFYVWPRHNKYEEFFANYDP---YTRMKEICAANKGYMHTCPKELAK 74

  Fly    83 KKDDKKK 89
            ..::|.|
 Worm    75 LYEEKGK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31644NP_001285640.1 Cyt_c_Oxidase_VIc 9..76 CDD:238467 15/57 (26%)
Y111B2A.2NP_001379273.1 Cyt_c_Oxidase_VIc 4..68 CDD:413484 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.