powered by:
Protein Alignment CG31644 and Y111B2A.2
DIOPT Version :9
Sequence 1: | NP_001285640.1 |
Gene: | CG31644 / 318868 |
FlyBaseID: | FBgn0051644 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379273.1 |
Gene: | Y111B2A.2 / 176675 |
WormBaseID: | WBGene00013728 |
Length: | 86 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 35/72 - (48%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 RNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDRM-----MSGGYLSSCPPGSGP 82
|.:.::..:|:::...|...:..||..||..|::.||| :.|| .:.||:.:||.....
Worm 13 RGIYVSLAVAVVSTAAFNAFYVWPRHNKYEEFFANYDP---YTRMKEICAANKGYMHTCPKELAK 74
Fly 83 KKDDKKK 89
..::|.|
Worm 75 LYEEKGK 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.