DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31644 and COX6C

DIOPT Version :9

Sequence 1:NP_001285640.1 Gene:CG31644 / 318868 FlyBaseID:FBgn0051644 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_004365.1 Gene:COX6C / 1345 HGNCID:2285 Length:75 Species:Homo sapiens


Alignment Length:74 Identity:22/74 - (29%)
Similarity:33/74 - (44%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEEKPPEFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDR 66
            ||..|   |..|..|..::...::.:|..|:|....|:.....:.||:.|.:||..||.|..|:.
Human     3 PEVLP---KPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEE 64

  Fly    67 MMSGGYLSS 75
            |...|...|
Human    65 MRKAGIFQS 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31644NP_001285640.1 Cyt_c_Oxidase_VIc 9..76 CDD:238467 19/67 (28%)
COX6CNP_004365.1 COX6C 5..74 CDD:367259 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1618740at2759
OrthoFinder 1 1.000 - - FOG0006275
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.