DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and AT4G29490

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_194678.2 Gene:AT4G29490 / 829070 AraportID:AT4G29490 Length:486 Species:Arabidopsis thaliana


Alignment Length:187 Identity:40/187 - (21%)
Similarity:75/187 - (40%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 YLYLRKMHIPNSEAVVEAVLTRSLQLIESQVDDEVIPLTSLSRLSVGINLERDFFTPLVCRNFIP 217
            :.||..:..|:....::....:|:..|....||..:.|..:..||   :.:..:...:|.  ::.
plant    65 FAYLFGVREPDFYGAIDIGSGKSILFIPRLPDDYAVWLGEIKPLS---HFKETYMVDMVF--YVD 124

  Fly   218 HLEHHINWCRSAEQVR-LLSTCLFQLHFL-IDEELFT---------RFKLRLTE----MMQSGVL 267
            .:....|     ||.: .....|:.||.| .|...|:         :|:..||.    :.:..|:
plant   125 EIIQVFN-----EQFKGSGKPLLYLLHGLNTDSSNFSKPASFEGIDKFETDLTTLHPILAECRVI 184

  Fly   268 SSETPKALLKVIHMLNIPVWSQTHTQLIREVMLVLRPCIHQMESADLKSICRTFLHH 324
            .|...   |::|...| .:.|:.|.:::|:|...::.  :||||        .||||
plant   185 KSSLE---LQLIQFAN-DISSEAHIEVMRKVTPGMKE--YQMES--------MFLHH 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
AT4G29490NP_194678.2 AMP_N 9..152 CDD:198079 18/96 (19%)
Prolidase 190..465 CDD:238520 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.