DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and XPNPEP3

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_071381.1 Gene:XPNPEP3 / 63929 HGNCID:28052 Length:507 Species:Homo sapiens


Alignment Length:458 Identity:88/458 - (19%)
Similarity:149/458 - (32%) Gaps:133/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 LESCPEKHLHLRFLRHCQRYMNFNNNLGGTYRHL-----------ELERKLSR-MCMNAIEHDIA 467
            |:..||:.:..|:|.....:         |:.||           ::|..|.| ..|:.|:.:..
Human    33 LQPVPERRIPNRYLGQPSPF---------THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQ 88

  Fly   468 GRLPAKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGIQD-CFLLSRGMQIASELRFRQ 531
            |:            ....||.:.... |.:.:|..:   |....|| .||...|.|....:...|
Human    89 GQ------------SGTDQTVVVLSN-PTYYMSNDI---PYTFHQDNNFLYLCGFQEPDSILVLQ 137

  Fly   532 HLPALAGMQLSTMDSILIGCAERHLRDAEKDPLNASE-------------LSMIVRTLSHRKKLK 583
            .||   |.||.:..:||........|:....|.:.::             |......|...|...
Human   138 SLP---GKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAET 199

  Fly   584 NTVVYNQALAQYKNLHCNDLNSRVVRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKV 648
            |.|.|:.....:..||                  |::..| |.|:.    ::..:.|.|  |:::
Human   200 NMVWYDWMRPSHAQLH------------------SDYMQP-LTEAK----AKSKNKVRG--VQQL 239

  Fly   649 LTCSYNLGYMPASVEALNHASEVLLRDFDQMSGLSVVQACLALCFYKSIPEQLINQVFCVKFIQR 713
            :. ...|...||.:|.:            |::|....||.:...|....|   :.:.|   ...:
Human   240 IQ-RLRLIKSPAEIERM------------QIAGKLTSQAFIETMFTSKAP---VEEAF---LYAK 285

  Fly   714 IEDEIQVCYSKA----TYPERVLNLVMQLNRTVCLDFPEANVPWFQQNYIEAQISKKS---LIPS 771
            .|.|   |.::.    .||.    :|...||:..|.:.:.|           |:.|..   |:..
Human   286 FEFE---CRARGADILAYPP----VVAGGNRSNTLHYVKNN-----------QLIKDGEMVLLDG 332

  Fly   772 --ESTTEVKQLLHQLLQNDKHFRCNHTTPYGYQIDFVIHFDRDKNPIPAPPVEATMLDRITKVAI 834
              ||:..|..:......|.:     .|.|.....:.|:...||...:..|   .|.|:.|..:.:
Human   333 GCESSCYVSDITRTWPVNGR-----FTAPQAELYEAVLEIQRDCLALCFP---GTSLENIYSMML 389

  Fly   835 LLL 837
            .|:
Human   390 TLI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 11/65 (17%)
FAST_2 736..816 CDD:285557 16/84 (19%)
RAP 834..894 CDD:214932 1/4 (25%)
XPNPEP3NP_071381.1 Interaction with TNFRSF1B. /evidence=ECO:0000269|PubMed:25609706 54..79 5/24 (21%)
PRK10879 67..506 CDD:182804 80/415 (19%)
AMP_N 72..205 CDD:282980 31/151 (21%)
Prolidase 252..490 CDD:238520 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.