DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and PEPD

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_000276.2 Gene:PEPD / 5184 HGNCID:8840 Length:493 Species:Homo sapiens


Alignment Length:555 Identity:104/555 - (18%)
Similarity:171/555 - (30%) Gaps:243/555 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LIDEELFTRFKLRLTEMMQSGVLSSETPKALLKVIHM-LNIPVW-----SQTH---------TQL 294
            |..:|.|..:...:||....||:..:|.|:.|.|..: .:...|     |:.|         .|.
Human    64 LFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQY 128

  Fly   295 IREVMLVL---RPCI---HQMESADLKSICR--------------TFLHHQEPAALIEPLKKALE 339
            :.|:..||   :|.:   .:..:.|..|:||              |.||.:    ::|       
Human   129 VDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPE----IVE------- 182

  Fly   340 KLLQEEGTADALFCAVPFATPLQRD--QYLHQFKELLYSEEAWQQPNASGHLFSVLRALKVSDIE 402
                         |.| |.|.::.:  :|.::.     |.||.::         |::|:||...|
Human   183 -------------CRV-FKTDMELEVLRYTNKI-----SSEAHRE---------VMKAVKVGMKE 219

  Fly   403 FCNTYWSGVVKELESCPEKHLHLR-FLRH------C-----QRYMNFNN---------------- 439
            :          ||||..|.:.:.| .:||      |     ...:::.:                
Human   220 Y----------ELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCL 274

  Fly   440 -NLGGTY----------------------RHLELERKLSRMCMNAIE--------HDIAGRLP-- 471
             ::||.|                      ...|...:.||..|.|::        |.:|.|:.  
Human   275 FDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLE 339

  Fly   472 --AKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGI--QDCFLLSRGMQIASE-----L 527
              |....|:..|.|..|..|.....|:       .:...|||  .|......|::...|     |
Human   340 ELAHMGILSGSVDAMVQAHLGAVFMPH-------GLGHFLGIDVHDVGGYPEGVERIDEPGLRSL 397

  Fly   528 RFRQHLPALAGMQLSTMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQAL 592
            |..:||.  .||.|:....|..  .:..|.:|..||..||.|:                      
Human   398 RTARHLQ--PGMVLTVEPGIYF--IDHLLDEALADPARASFLN---------------------- 436

  Fly   593 AQYKNLHCNDLNSRVVRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGY 657
                            |::...|..            |..:..:.|.|..|:..::|||      
Human   437 ----------------REVLQRFRG------------FGGVRIEEDVVVTDSGIELLTC------ 467

  Fly   658 MPASVEALNHASEVLLRDFDQMSGLSVVQACLALC 692
            :|.:||.                    ::||:|.|
Human   468 VPRTVEE--------------------IEACMAGC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 10/46 (22%)
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
PEPDNP_000276.2 AMP_N 18..155 CDD:198079 20/90 (22%)
Prolidase 192..467 CDD:238520 64/359 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.