DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and Dip-C

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster


Alignment Length:187 Identity:36/187 - (19%)
Similarity:64/187 - (34%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 KKLKNTVV--------YNQALAQYKNLHCNDLNSRVVRDMAYNFNASNFFVP-----------EL 625
            :.|.||.|        |.|.|...|...|..:   :..|:......|..|||           ||
  Fly    53 QSLYNTDVDYVFRQESYFQYLFGVKEPGCYGI---LTIDVKTGAQKSVLFVPRFPDEYGTWMGEL 114

  Fly   626 L-----ESMFA-----YISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRDFDQMS 680
            |     ::|:.     |:.|...::.|.:.:.:||.|           ..|..|.:.|:..|...
  Fly   115 LGLQEFKAMYEVDEVFYVDEMSVYLEGASPKLILTLS-----------GTNSDSGLTLQPPDFAG 168

  Fly   681 GLSVVQAC------LALCFYKSIPEQLINQVFCVKFIQRIEDEIQVCYSKATYPERV 731
            ....|..|      |:.|.....||    ::..::::.::..:..:...:...|.|:
  Fly   169 KEKYVTDCNLLYPILSECRVIKSPE----EIEVLRYVAKVSSDAHIKVMRFMRPGRM 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 13/71 (18%)
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 25/118 (21%)
PRK10879 57..483 CDD:182804 35/183 (19%)
Prolidase 195..468 CDD:238520 2/27 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.