DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and pepd

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_944594.1 Gene:pepd / 337498 ZFINID:ZDB-GENE-030131-9444 Length:496 Species:Danio rerio


Alignment Length:361 Identity:70/361 - (19%)
Similarity:119/361 - (32%) Gaps:114/361 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LKVIHMLNIPVWSQTHTQLIREVMLVLRPCIHQMES--------------ADLKSIC-----RTF 321
            |:|:...| .:.|:.|.:::|.|...|:.  ::|||              .....||     .:.
Zfish   193 LEVLRYTN-RISSEAHKEVMRRVKPGLKE--YEMESLFQHYCYSRGGMRHTSYTCICGSGNNSSI 254

  Fly   322 LHHQEPAALIEPLKKALEK----LLQEEGT----ADALFCAVPFATPLQRDQYLHQFKELLYSEE 378
            ||:....|   |..|.::.    |....|.    :..:.|:.|.......||.. .::.:|.|..
Zfish   255 LHYGHAGA---PNDKTIQDGDMCLFDMGGEYYCYSSDITCSFPANGKFTADQRT-IYEAVLKSSR 315

  Fly   379 A----------WQQPNASGHLFSVLRALKVSDIEFCNTYWSGVVK-ELESCPEKHLHLRFLRHCQ 432
            |          |...:.......:...||:           |::. ::|...:.||...|:.|  
Zfish   316 AVMAAIKPGVKWTDMHRLADRVHLEELLKI-----------GILHGDVEEMLKVHLGSVFMPH-- 367

  Fly   433 RYMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAG------RL------PAKFARLASFVLAYG 485
                   .||    ||          :....||:.|      |:      ..:..|:....:...
Zfish   368 -------GLG----HL----------LGIDVHDVGGYPEGVERVHEPGLKSLRMGRVVQERMVLT 411

  Fly   486 QTPLAWKKFPNFLLSKMLAMAPQLGIQDCFLLSR-----GMQIASELRFRQHLPALAGMQLSTMD 545
            ..|..:  |.|.||.|.||...|.|..:..:|:|     |::|..::..             |.|
Zfish   412 VEPGIY--FINHLLDKALASPAQCGFINTAVLTRFRGFGGVRIEDDIAV-------------TAD 461

  Fly   546 SI-LIGCAERHLRDAEKDPLNASELSMIVRTLSHRK 580
            .: |:.|..|.:.:.|  ...|.|.|.....:|.:|
Zfish   462 GVELLTCVPRTVEEIE--AFMAEETSKPFSPISSQK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
pepdNP_944594.1 AMP_N 19..156 CDD:198079
PRK13607 47..467 CDD:237444 62/329 (19%)
Prolidase 193..468 CDD:238520 62/330 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.