DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and CG9581

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_608376.1 Gene:CG9581 / 33017 FlyBaseID:FBgn0031093 Length:545 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:115/406 - (28%) Gaps:135/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PNSEAVVEAVLTRSLQLIESQVDDEVIPLTSLSRLSVGINLERDFFTPLVCRNFIPHLEHHINWC 226
            |:|::.|.|...|.:..|..|....:...||:|.                     ||        
  Fly    42 PSSKSTVNAAEVRGVAQILRQQKGNLGQPTSVSH---------------------PH-------- 77

  Fly   227 RSAEQVRLLSTCLFQLHFLIDEELFTRFKLRLTEMMQSGVLSSETPKALLKVIHMLNIPVWSQT- 290
                        |.|...|:.....|..|.|.:::||                   ||..:::: 
  Fly    78 ------------LIQPDELVPGVELTEIKERRSQLMQ-------------------NIRAYARSF 111

  Fly   291 ------HTQLIREVMLVLRPCIHQMESADLKSICRTFLHHQEPAALIEPLKKALEKLLQEEGTAD 349
                  |:....  ||||.....:..|..:..:.|...........:||....|..:.:.:....
  Fly   112 GGEFNGHSSSCH--MLVLGAASKKYMSGKIPYVFRQNSDFYYLTGCLEPDAVLLLTIDEAQNVQS 174

  Fly   350 ALFCAVPFATPLQRDQYLHQFKELLYSEEAWQQPNASGH----LFSVLRALKVSDIEFCNTYWSG 410
            .||         .|.:..|        .|.|..|.....    ||.|..|..:|.:|......:|
  Fly   175 ELF---------MRPKDPH--------AELWDGPRTGPELAVPLFGVTEAHPLSQLEAVLAKRAG 222

  Fly   411 VVK----------ELESCPEKHLHLRFLRHCQRYMNFNNNLGGTYRHLELERKLS---------R 456
            .:|          :|.|..|..|.|.        .|....|...|..||..|.|.         |
  Fly   223 ALKPHIWFDQKSTDLPSLAENMLRLS--------GNQQRPLLPAYTFLEAMRLLKSRDEMQLMRR 279

  Fly   457 MC------MNAI---------EHDIAGRLPAKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMA 506
            .|      .|.:         ||.:...:..|.....:..|||.....|.|   |..:...:|.:
  Fly   280 TCDIASRSFNEVMAETRPGQSEHHLFAAIDYKCRMRNASYLAYPPVVAAGK---NATVIHYVANS 341

  Fly   507 PQLGIQDCFLLSRGMQ 522
            ..||.||..|:..|.:
  Fly   342 QLLGQQDLVLMDAGCE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
CG9581NP_608376.1 AMP_N 94..232 CDD:282980 31/175 (18%)
Prolidase 274..517 CDD:238520 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.