DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and CG2124

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_572638.1 Gene:CG2124 / 31989 FlyBaseID:FBgn0030217 Length:629 Species:Drosophila melanogaster


Alignment Length:602 Identity:114/602 - (18%)
Similarity:224/602 - (37%) Gaps:184/602 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YLRKMHIPNSEAVVEAVLTRSLQLIESQVDDEVI-PLTSLSRLSVGINLERDFFTPLVCRNFIPH 218
            :..:|.:..|::..||......:.:....|:::: .|::|:.|.|..:               |.
  Fly    90 HCNRMELKISDSRYEAFTRCFCEQLHRLTDEQLLGSLSALAELPVPES---------------PK 139

  Fly   219 LEHHIN-W-------CR-----SAEQVRLLSTCLFQLHFL-IDEELFTRFKLRLTEMMQSGVLSS 269
            .::::. |       ||     |:||:.|:|...::|..: |.|.::    |.|.::.:.  |..
  Fly   140 AKNYMEIWNTLDIECCRRIERWSSEQLLLVSDAWYRLGLVRIGEYVW----LALKKLGRK--LRK 198

  Fly   270 ETPKALLKVIHMLNI---PVWSQTHTQLIREVMLVLRPCIHQMESADLKSICRTFLHHQEPAALI 331
            ..|:.|:..:.:.|:   ||:.      :.:..|.|..|:.||..::|..:...|...|.|....
  Fly   199 LPPEQLVHSMFLCNLLRRPVFE------MFDFELNLARCVDQMTLSELGVMAMGFFKTQTPIRNP 257

  Fly   332 EPLKKALEKLLQEEGTAD-----ALFCAVPFATPLQRDQYLHQFKELLYSEEAWQQPNASGHLFS 391
            |.|.:..::|..|..|.:     ||...:.:::.|.:   :...|::|.:.|:  |.:....|..
  Fly   258 ELLTQLYQRLGSELDTVEDIVLVALLKVLRYSSKLPQ---VEPLKKMLSALES--QVDRVSLLTC 317

  Fly   392 VLRALKVSDIEFCNTYWSGVVKELESCPEKHLHLRFLRHCQRYMNFNNNLGGTYRHLELE----R 452
            :..||...:::.||          ::..|:.| |||.|                   |||    :
  Fly   318 LHMALLGCELQTCN----------DALVERIL-LRFER-------------------ELETARLK 352

  Fly   453 KLSRMCM----------NAIEHDIAGRLPAKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAP 507
            .:.|:|:          :.:|..:|.|||....:....:|.:   |..:.....||..:      
  Fly   353 DMERICLVMALFNITTKSGVERRLAERLPDLLRQRIEEILRH---PRCFSNCLQFLTMR------ 408

  Fly   508 QLGIQDCFLLSRGMQIASELRFRQHL--PALAGMQLSTMDSI--LIGCAERHLRDAEKDPLNASE 568
              |:.|..||.    :|.|.||.:|.  ..|.|.:...:|..  |:|                .|
  Fly   409 --GVYDLELLG----VALEPRFLKHAYPSGLPGREYFHLDGFARLLG----------------PE 451

  Fly   569 LSMIVRTLSHRKKLKNTVVYNQALAQYKNLHCNDLNSRVVRDMAYNFNASNFFVPELLESM---- 629
            ....:.|...|:::...  |.|.:..              ||..:..|.::..:.|:.:::    
  Fly   452 YQGALVTEKQRQQMGRN--YTQYIPD--------------RDGRFKLNNTDRILVEIRDAITMIH 500

  Fly   630 ----FAYISEQHDH----------------VSGDTVE----KVLTCSYNLGYMPASVEALNHASE 670
                |.:|..|:|.                ::|:..:    ::||..:.||...|:.:.|.....
  Fly   501 RPVTFKHILPQYDRCDVVLCYDRRQRKALSINGEACQDYSGEILTRKHLLGERKAADDQLVTVVI 565

  Fly   671 VL------LRDFDQMSG 681
            |:      :||.|:.:|
  Fly   566 VIAGWNNVIRDKDRFTG 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 11/41 (27%)
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
CG2124NP_572638.1 RAP 565..622 CDD:214932 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.