DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and CG32454

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_730740.1 Gene:CG32454 / 318037 FlyBaseID:FBgn0260481 Length:534 Species:Drosophila melanogaster


Alignment Length:360 Identity:64/360 - (17%)
Similarity:117/360 - (32%) Gaps:106/360 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 MLNIP-VWSQTHTQLIREVMLVLRPCIHQMESADLKSICRTFLHHQEPAALIEPLKKALEKLLQE 344
            :|.:| ||....|:.||.:.:   |.:.:..|.|            .|......:.:.|....:.
  Fly    32 LLVLPTVWPSELTKRIRPLSV---PDLIEKFSCD------------APGGQFATMSEYLRSDPRP 81

  Fly   345 EGTADALFCAVPFATPLQRDQYLHQFKELLYSEEAWQQPNASGHLFSVLRALKVSDIEFCNTYWS 409
            :|.      .:|....|.|...|......:::::|:::|:....:||  ..|.|:..:...:|  
  Fly    82 DGV------LLPDEIDLHRKMSLDDLNSYMHAKDAFKEPHRKNRIFS--HVLVVAGADSARSY-- 136

  Fly   410 GVVKELESCPEKHLHLRFLRHCQRYMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIAGRLPAKF 474
                .....|:    ..:|..|.|        .|....|...||.:...:..:..|:..:|...|
  Fly   137 ----PFRQRPD----FLYLCDCLR--------PGAALVLTRSRKRNTGALLFLSQDVDSQLSTIF 185

  Fly   475 ARL--ASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGIQDCFLLSRGMQIASELRFRQHLPALA 537
            :.:  ...||     |||       :|.|.|          .:||            |.|.|.| 
  Fly   186 SHMHYVDDVL-----PLA-------MLKKSL----------LWLL------------RDHSPEL- 215

  Fly   538 GMQLSTMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKL-----KNTVVYNQALAQYKN 597
                            .|..|.      :|.:|.||:.:::..|:     :..:.|.:.:...:.
  Fly   216 ----------------WHFYDP------SSPVSCIVQEVANEAKIPMGNPRYILQYTRTVKTSRE 258

  Fly   598 LHCNDLNSRVVRDMAYNFNASNFFVPELLESMFAY 632
            |......:....|......|.:..:|:.|.:.|.|
  Fly   259 LRALRRANATAADSMAEVIAQHHQIPQELAASFDY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
CG32454NP_730740.1 Creatinase_N 106..223 CDD:304957 34/193 (18%)
APP_MetAP 259..468 CDD:294199 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.