DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and Pepd

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001009641.1 Gene:Pepd / 292808 RGDID:1594571 Length:492 Species:Rattus norvegicus


Alignment Length:75 Identity:18/75 - (24%)
Similarity:30/75 - (40%) Gaps:28/75 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 FFVPELLESM--FAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRDFDQMSGL 682
            ||..|:|:..  |..:..:.|.|..|:..::|||      :|.:||.                  
  Rat   434 FFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTC------VPRTVEE------------------ 474

  Fly   683 SVVQACLALC 692
              ::||:|.|
  Rat   475 --IEACMAGC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 10/46 (22%)
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
PepdNP_001009641.1 AMP_N 18..155 CDD:198079
PepP 52..476 CDD:223085 14/67 (21%)
Prolidase 192..467 CDD:238520 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.