powered by:
Protein Alignment CG31643 and Pepd
DIOPT Version :9
Sequence 1: | NP_001285652.1 |
Gene: | CG31643 / 318867 |
FlyBaseID: | FBgn0051643 |
Length: | 899 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001009641.1 |
Gene: | Pepd / 292808 |
RGDID: | 1594571 |
Length: | 492 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
Similarity: | 30/75 - (40%) |
Gaps: | 28/75 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 620 FFVPELLESM--FAYISEQHDHVSGDTVEKVLTCSYNLGYMPASVEALNHASEVLLRDFDQMSGL 682
||..|:|:.. |..:..:.|.|..|:..::||| :|.:||.
Rat 434 FFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTC------VPRTVEE------------------ 474
Fly 683 SVVQACLALC 692
::||:|.|
Rat 475 --IEACMAGC 482
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D352329at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.