DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31643 and R119.2

DIOPT Version :9

Sequence 1:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_490725.3 Gene:R119.2 / 187899 WormBaseID:WBGene00020088 Length:444 Species:Caenorhabditis elegans


Alignment Length:281 Identity:52/281 - (18%)
Similarity:104/281 - (37%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 WSGVVKELESCPEKHLHLRFLRHCQR-----YMNFNNNLGGTYRHLELERKLSRMCMNAIEHDIA 467
            |....|..|..|...:.....:.|.:     :.:.:::|  .|:.::.:....|...:.||....
 Worm   119 WEKTAKFTECVPTSRILQTLEKVCDKGTAVFFDSTSDDL--LYKFVQAKANSVREINHFIERRRV 181

  Fly   468 GRLPAKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGIQD--CFLLS-RGMQIASELRF 529
            .:.|::.:.:........||           :|.|::.:..|..::  |.||. .|.:..||:  
 Worm   182 IKSPSEMSSMRDVCNVGAQT-----------MSSMISGSRDLHNENAICGLLEFEGRRRGSEM-- 233

  Fly   530 RQHLPALA-GMQLSTMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYNQALA 593
            :.:.|.:| |::.:|:          |..||..| ||..|..::                     
 Worm   234 QAYPPVIAGGVRANTI----------HYLDANND-LNPRECVLV--------------------- 266

  Fly   594 QYKNLHCNDLNSRVVRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYNLGYM 658
               :..| |||. .|.|:...|..|.|:....| |::..:...|        |::||.::::..:
 Worm   267 ---DAGC-DLNG-YVSDVTRCFPISGFWSDAQL-SLYEALLYVH--------EELLTYAHSMEKV 317

  Fly   659 PASVEALNHASEVLLRDFDQM 679
            ..|. .....:|:|...|.::
 Worm   318 RLSA-LFRRMNELLAASFTEL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 6/33 (18%)
FAST_2 736..816 CDD:285557
RAP 834..894 CDD:214932
R119.2NP_490725.3 AMP_N 20..149 CDD:377484 5/29 (17%)
APP_MetAP 188..427 CDD:381919 41/210 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.