DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Ttpal

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_083788.2 Gene:Ttpal / 76080 MGIID:1923330 Length:343 Species:Mus musculus


Alignment Length:246 Identity:81/246 - (32%)
Similarity:119/246 - (48%) Gaps:9/246 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQ-PHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIP 81
            ||.|.|....:|::||||.|.|: |:|....||.|||.|||..||..:||.:....::..:||.|
Mouse    47 ELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRRSWP 111

  Fly    82 EVFNERRLATDPQVL-DIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGE 145
            |||:..|    |..| |::..|.|..:| ..|..|..|..||...:..|.:...:.||...:..|
Mouse   112 EVFSNLR----PSALKDVLNSGFLTVLP-HTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLE 171

  Fly   146 IMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFET 210
             .:.:.:...|:|.|.:.|..||:.|......|.:..|......:..|.|.|.:|.:|.|..|:.
Mouse   172 -KLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKG 235

  Fly   211 GFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGGTGGNLQDIS 260
            .|..::.|...||.:|..: .||..:::..:.|..||:|||||.|.|...|
Mouse   236 IFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRNILPKEYGGTAGELDTAS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 21/45 (47%)
SEC14 96..252 CDD:238099 43/157 (27%)
TtpalNP_083788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CRAL_TRIO_N 57..103 CDD:215024 21/45 (47%)
SEC14 122..278 CDD:238099 43/157 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.