DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Clvs1

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001342112.1 Gene:Clvs1 / 74438 MGIID:1921688 Length:354 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:132/275 - (48%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVRPLNAALQEICIR----ELNELPARMAQDIEALRDWVLKQP---HLRACTDDQFLLAFLRG 58
            ::.:..|.|.|....|.    ||||.|..:.|||:.:||.::.:|   .||  |||.|:|.|||.
Mouse    20 LAKMTHLQAGLSPDTIEKARLELNENPDILHQDIQQVRDMIITRPDIGFLR--TDDAFILRFLRA 82

  Fly    59 TKFSLERAKEKFDRFYTLQRSIPEVFNERRL---------ATDPQVLDIVRM------GVLLQIP 108
            .||      .:.|.|    |.:.:.|..|:|         |.||   .|.|.      |||    
Mouse    83 RKF------HQADAF----RLLAQYFQYRQLNLDMFKNFKADDP---GIKRALIDGFPGVL---- 130

  Fly   109 MDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHL 173
            .:.|..|.::.::.|.::|.|::.|.||:|...:..|::: ||....::|::.|:|.:..:....
Mouse   131 ENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLI-EDPELQINGFILIIDWSNFSFKQA 194

  Fly   174 FALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISV-SSDPAAIY 237
            ..|.|.:|........::.|.|..|:||:|.|......:..::.|...|.:.||.: .::..:::
Mouse   195 SKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLH 259

  Fly   238 ELVRRKYLPQEYGGT 252
            :|:..::||.|:|||
Mouse   260 QLIHPEFLPSEFGGT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 18/47 (38%)
SEC14 96..252 CDD:238099 39/162 (24%)
Clvs1NP_001342112.1 CRAL_TRIO_N 51..97 CDD:215024 21/57 (37%)
CRAL_TRIO 125..274 CDD:366224 37/153 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4693
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.