DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and TTPA

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:267 Identity:71/267 - (26%)
Similarity:107/267 - (40%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQPHLRAC---------------TDDQFLLAFLRGTKFSLERAK 67
            :||.||....          |.||.|.|.               ..|.|||.|||...|.|:.|.
Human    13 QLNALPDHSP----------LLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARDFDLDLAW 67

  Fly    68 EKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRM------GVLLQIPMDADDPGPRVTIIRAGSY 126
            .....:|..:...||:      :.|.....|:.:      |||    ...|..|.:|.|.|...:
Human    68 RLLKNYYKWRAECPEI------SADLHPRSIIGLLKAGYHGVL----RSRDPTGSKVLIYRIAHW 122

  Fly   127 DTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEA 191
            |.......|:.||..:..|:::.|.:... :|...|.|:.|...||.|.:.|.:..|.:....::
Human   123 DPKVFTAYDVFRVSLITSELIVQEVETQR-NGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDS 186

  Fly   192 MPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKY----LPQEYGGT 252
            .|.:.:|||.||.|..|...|:.::.|...|||.||.:..:.   |:....::    ||.||||.
Human   187 FPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNN---YKQSLLQHFPDILPLEYGGE 248

  Fly   253 GGNLQDI 259
            ..:::||
Human   249 EFSMEDI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 15/59 (25%)
SEC14 96..252 CDD:238099 45/165 (27%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/6 (67%)
CRAL_TRIO_N <40..73 CDD:215024 10/32 (31%)
CRAL_TRIO 99..248 CDD:395525 44/156 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.