DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and RLBP1

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:246 Identity:62/246 - (25%)
Similarity:110/246 - (44%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTL 76
            :|..:|||.|:....|...|.|...|.::...:   |..|.|.|:|..||::.||.|....:...
Human    68 REEAVRELQEMVQAQAASGEELAVAVAERVQEK---DSGFFLRFIRARKFNVGRAYELLRGYVNF 129

  Fly    77 QRSIPEVFNERRLATDPQ----VLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDII 137
            :...||:|:    :..|:    .::....|||    ...|..|..|.:....::.:.:..|.:|:
Human   130 RLQYPELFD----SLSPEAVRCTIEAGYPGVL----SSRDKYGRVVMLFNIENWQSQEITFDEIL 186

  Fly   138 RVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFI 202
            :......| .:.|::...::|:..|.:..|.|.....:|:...|.|......::.|.|.|.||||
Human   187 QAYCFILE-KLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHFI 250

  Fly   203 NVPAAFETGFNSLRSFFPAKIKSRISVSSDP-AAIYELVRRKYLPQEYGGT 252
            :.|..|.|.:|.::.|..:|:..|:.|..|. :..|:.:....||.::|||
Human   251 HQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 14/44 (32%)
SEC14 96..252 CDD:238099 37/156 (24%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.