DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG11550

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:297 Identity:80/297 - (26%)
Similarity:134/297 - (45%) Gaps:32/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EALR--DWVLKQPHLRACTDDQF----LLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVF----N 85
            |.|:  ||:..|||:    .|:|    .|.|....::|:|.||:..|...|.:..:.|.|    .
  Fly    20 EVLKFLDWIHAQPHI----SDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLDC 80

  Fly    86 ERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFE 150
            ||     |::...:|...::.:| .|...|.||.:.:....:||.:.|.|::::..|..:..|:|
  Fly    81 ER-----PEIRRAMRTVSIVPLP-GATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYE 139

  Fly   151 DDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSL 215
            |  ....|:|.::|:...:..|:..:....:.||..|..||...|..|.||||:....:.....:
  Fly   140 D--GIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALM 202

  Fly   216 RSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQNF 280
            ..|...::.:.:.:.||....|:.|.::.||:||   ||.|::.:...|..........:|...|
  Fly   203 TPFMKKELTTVLHMHSDLKEFYKFVPQEMLPKEY---GGQLEEANVAKEIYYKKLLDNRKEMIEF 264

  Fly   281 ----GANDKLREFGDHKRGNHRSSFGAVGSFRKLEID 313
                ..|:|||   ..|..|....||..|:|:||:||
  Fly   265 ETRHQVNEKLR---PGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 15/46 (33%)
SEC14 96..252 CDD:238099 38/155 (25%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.