DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG32407

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:228 Identity:40/228 - (17%)
Similarity:85/228 - (37%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PARMAQDIEALRDWVLKQP--------HLRACTD-DQFLLAFLRGTKFSLERAKEKFDRFYTLQR 78
            |.:::|...::...:.|:|        .|:..|| |.::...|:...|.:|:.            
  Fly     9 PEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKC------------ 61

  Fly    79 SIPEVFNERRLATDPQVLDIVRMGVLLQIPMDA-------DDPGPRVTIIRAGSYDTSKHKFQDI 136
             |..:::.........|.||....:..:...|.       |..|..:.|:....:..|::: :|:
  Fly    62 -ITRLWDNLAWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQ-EDL 124

  Fly   137 IRVGSMFGEIMMFED--DNATVSGYVEIMDMAGVTGSHL-FALQPQLLSKFSTYADEAMPTRQKG 198
            :|:...:.|.:..:.  |..|:     .|||.|...|:| ......::..|.|    ..|.....
  Fly   125 LRILVFWIERLQRDSNLDKITI-----FMDMTGAGLSNLDMGFIKSIIGVFET----KYPYVPNY 180

  Fly   199 IHFINVPAAFETGFNSLRSFFPAKIKSRISVSS 231
            |...::|...:..|..:::|.|.:....:.|::
  Fly   181 ILVHDLPFLLDAAFKLVKTFLPPEALKILKVTT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 10/53 (19%)
SEC14 96..252 CDD:238099 27/146 (18%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 25/132 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.