DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG13893

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:360 Identity:78/360 - (21%)
Similarity:128/360 - (35%) Gaps:82/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPE 82
            |::|....:.:......|..|...|     ||.||:.:||..|::|| |.||..|.....|::..
  Fly     7 EISEEQRAILEKFRKQMDDALVGTH-----DDYFLVRWLRARKWNLE-AAEKMLRASLKTRAMWN 65

  Fly    83 VFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYD-------TSKHKFQDIIRVG 140
            |.|..:......:.:.:..|:     |..|:.|..|.:....::|       .::.:||..:.: 
  Fly    66 VDNIEKWDPPKALQEYLPYGL-----MGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVL- 124

  Fly   141 SMFGEIMMFEDDNATVSGY-----VEIMDMAGVTGSHLFALQPQ---LLSKFSTYADEAMPTRQK 197
             :....|....|.:...|:     |...||..|.... :|.:|.   ::|....| :...|...|
  Fly   125 -LLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQ-YAWRPAAECVISTVKQY-EANFPELLK 186

  Fly   198 GIHFINVPAAFETGFNSLRSFFPAKIKSRI-----SVSSDPAAIYELVRRKYLPQEYGGT----- 252
            ..:.||.|..|...||.::.|......|:|     .|......::..|.||..|:.:||.     
  Fly   187 MCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRN 251

  Fly   253 -----------GGNLQDISHTMEAKLSSYGPYFRESQNFGANDKLR------------------- 287
                       ||.|.:..:..::...| ...|.|:| ....|||:                   
  Fly   252 GDPQCKALMVWGGKLPEELYIDQSSQQS-DRDFVEAQ-VPKGDKLKLHFKVNVEEQKILSWEFRT 314

  Fly   288 -----EFG----DHKRGNHRSSFGAVGSFRKLEID 313
                 :||    |.|.|..||.. .:|:....|:|
  Fly   315 FDYDIKFGIYSVDDKTGEKRSEV-PLGTVYSNEMD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 15/44 (34%)
SEC14 96..252 CDD:238099 36/175 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 16/46 (35%)
SEC14 75..246 CDD:238099 36/179 (20%)
GOLD_2 303..381 CDD:290608 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.