DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Clvs2

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:170 Identity:53/170 - (31%)
Similarity:87/170 - (51%) Gaps:14/170 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQP---HLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRS 79
            ||||.|..:.|||:.:||.|:.:|   .||  |||.|:|.|||..||....|.....:::..::.
  Rat    19 ELNENPDTLHQDIQEVRDMVITRPDIGFLR--TDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQ 81

  Fly    80 IPEVFNERRLATDPQVLDIVRMGVLLQIP---MDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGS 141
            ..::|...: ||||.:...::.|    .|   .:.|..|.::.::.|.::|.|::...||:|...
  Rat    82 NLDMFKSFK-ATDPGIKQALKDG----FPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAIL 141

  Fly   142 MFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLL 181
            :..|.|: ||....|:|:|.|:|.:..|......|.|.:|
  Rat   142 LSLEAMI-EDPELQVNGFVLIIDWSNFTFKQASKLTPSML 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 20/47 (43%)
SEC14 96..252 CDD:238099 23/89 (26%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 20/47 (43%)
SEC14 103..>204 CDD:301714 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.