DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:272 Identity:57/272 - (20%)
Similarity:96/272 - (35%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYT 75
            |||.|:..              ||.| |::.|......|:.:|.|||...|::::|:|...:..|
  Rat   255 LQESCLIR--------------LRQW-LQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQSLT 304

  Fly    76 --LQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIR 138
              .|..:..:.:   ..|.||||.....|..    ...|..|..:.::|.|..||     :.::|
  Rat   305 WRKQHQVDYILD---TWTPPQVLQDYYAGGW----HHHDKDGRPLYVLRLGQMDT-----KGLVR 357

  Fly   139 VGSMFGEIMMFE-------------DDNATV-----SGYVEIMDMAGVTGSHLFALQPQLLSKFS 185
            .   .||..:..             ::|..|     |.:..::|:.|:...||:....:.|.:..
  Rat   358 A---LGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRII 419

  Fly   186 TYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAAIYELVRRKYL---PQ 247
            ...:...|.....:..:..|..|...:..:..|                 |.:..|||:|   ..
  Rat   420 EVVEANYPETLGRLLILRAPRVFPVLWTLVSPF-----------------IDDNTRRKFLIYAGN 467

  Fly   248 EYGGTGGNLQDI 259
            :|.|.||.|..|
  Rat   468 DYQGPGGLLDYI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 13/44 (30%)
SEC14 96..252 CDD:238099 29/176 (16%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 15/59 (25%)
CRAL_TRIO 327..491 CDD:279044 33/182 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.