DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG10026

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:119/270 - (44%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNAALQEI------CIRELNELPARMAQDIEALRDWVLK----QPHLRACTDDQFLLAFLRGTKF 61
            ||...:|:      ..:|..|.|:...:.||..|:::|:    |||.   :|.::|..|||...:
  Fly    17 LNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHR---SDAKYLEKFLRARYW 78

  Fly    62 SLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGV--LLQIPMDADDPGPRVTIIRAG 124
            .:|.:.:....:|..:......:.:.|      .||:..:|.  :|.:....|..|.|:.|.|.|
  Fly    79 KIENSYKLLCSYYRFREQNKSFYEKVR------PLDLRHVGQSDILTVTPYRDQHGHRILIYRFG 137

  Fly   125 SYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYAD 189
            .:..::....||.|...:..|:...|..:..|.| |.|.|:..:...|:..|.|.:..|......
  Fly   138 LWRPNQVTVDDIFRATIVLQELGSLEPISQIVGG-VGIFDLKDLGLEHILHLSPSVAQKMIALLV 201

  Fly   190 EAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGGTG 253
            .:||.|...:|.:|....|...|...:.|..|.::.::.: .||..::::.:..::||:.|||..
  Fly   202 TSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLH 266

  Fly   254 GNLQDISHTM 263
               :|.|:|:
  Fly   267 ---EDYSYTL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 13/48 (27%)
SEC14 96..252 CDD:238099 39/158 (25%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 13/49 (27%)
SEC14 112..265 CDD:238099 37/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.010

Return to query results.
Submit another query.