DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG5973

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:251 Identity:62/251 - (24%)
Similarity:108/251 - (43%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTL------ 76
            ||.|:|....|.|:.||:.:..:.:|....||::::.|||.|.:..|.|.::...||.:      
  Fly    42 ELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGA 106

  Fly    77 --QRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAG-SYDTSKHKFQDIIR 138
              :..||.           ::.::....:|..:| ..|..|.|:.::.|| .:..|:....|:.|
  Fly   107 ACENIIPS-----------KLRNVFEANILNLLP-QRDQHGRRLLVLEAGKKWKPSQVPLVDLFR 159

  Fly   139 ------VGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQK 197
                  :|||.       :..:.:.|.|.|:||.|:..||:....|...:....|..|.:..|.|
  Fly   160 GIQLTVLGSMV-------EPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLK 217

  Fly   198 GIHFINVPAAFETGFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGGT 252
            .:|.:|....|...|...:.|...|::.||.. ..|..::...:..|.||.:|||:
  Fly   218 AVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 13/44 (30%)
SEC14 96..252 CDD:238099 40/163 (25%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/44 (30%)
SEC14 116..272 CDD:238099 39/163 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.010

Return to query results.
Submit another query.