DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG31826

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:96/260 - (36%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQ 94
            ||.||..|.|...||..|:|..|..||..|::...:|.:....:|..:|..|.......:....|
  Fly    18 IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPIEHYRQ 82

  Fly    95 VLDIVRMGVLLQIPMDADDPGPRVTII--RAGSYDTSKHKFQDIIRVGSMFGEIMMF----EDDN 153
            :.    .|...:..|...|...||.::  ....:.......|.::.:..:..|.::.    :.:.
  Fly    83 LF----YGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDDLIFESLLLLPRVQQNG 143

  Fly   154 ATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSF 218
            .||     |.|:.|...:.|....|..: |.....:..:|..|:.:|.|...............|
  Fly   144 ITV-----ICDLQGTNRNFLRQFSPAFM-KVVNEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPF 202

  Fly   219 FPAKIKSRISVSSDP--AAIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQNFG 281
            ...:.|.:|......  :.:.|:|..:.||.||||...|:.| ::.:...||....|..:.|.:|
  Fly   203 MNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLD-TNLIFNHLSQNAEYLEKLQTYG 266

  Fly   282  281
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 15/41 (37%)
SEC14 96..252 CDD:238099 29/163 (18%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 15/42 (36%)
CRAL_TRIO 92..237 CDD:279044 27/150 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.