DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and CG3823

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:300 Identity:79/300 - (26%)
Similarity:118/300 - (39%) Gaps:29/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLA 90
            |...|..|:||:..||.|........|..||..|:..|..|:...:..|.|:.....:|.:|   
  Fly    13 MTTRISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDR--- 74

  Fly    91 TDP---------QVLDIVRMGVLLQIPMDADDP-GPRVTIIRAGSYDTSKHKFQDIIRVGSMFGE 145
             ||         ||.|:|        |:....| ..::...|...:|..|..|...|:|..|..:
  Fly    75 -DPLDASSQQLLQVADLV--------PLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMVAD 130

  Fly   146 IMMFEDDNATVS-GYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFE 209
            .....::...:| |.:.:.||||.|..||.......|..:..:..||.|.|.|.||.:|.|:..:
  Fly   131 CRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSYVD 195

  Fly   210 TGFNSLRSFFPAKIKSRISVSSDPA-AIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLSSYGPY 273
            .....::.|...::...|......| ..|....|..||:||||..|.:.|:.......|.....|
  Fly   196 KVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQRDY 260

  Fly   274 FRESQNFGANDKLREFGDHKRGNHRSSFGAVGSFRKLEID 313
            ..:::|:..| |:::.|..|    .|..|.....|.||||
  Fly   261 LMDTENWQIN-KIKKNGQRK----SSDSGVTEGLRSLEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 13/44 (30%)
SEC14 96..252 CDD:238099 40/158 (25%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.