DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31636 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:323 Identity:55/323 - (17%)
Similarity:113/323 - (34%) Gaps:76/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFD 71
            |:|...|.|:..|:.:   ....:..||.| |::.|......|:.:|.|||...|.|::|::...
  Rat   226 LDADYIERCLGHLSPM---QESCLVQLRRW-LQETHKGKIPKDEHILRFLRARDFHLDKARDMLC 286

  Fly    72 RFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQ-----IPMD---------ADDPGPRVTIIR 122
            :..:.::.                   .::.:|||     .|:.         .|..|..:.|:|
  Rat   287 QSLSWRKQ-------------------HQVDLLLQTWRPPAPLQEFYAGGWHYQDIDGRPLYILR 332

  Fly   123 AGSYDT--------SKHKFQDIIRVGS-----------MFGEIMMFEDDNATVSGYVEIMDMAGV 168
            .|..||        .:...|.::.|..           .||.         .:|.:..::|:.|:
  Rat   333 LGQMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGR---------PISSWTCLLDLEGL 388

  Fly   169 TGSHLFALQPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSS-- 231
            ...||:....:.|.:.....::..|.....:..:..|..|...:..:..|.....:.:..:.|  
  Rat   389 NMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGS 453

  Fly   232 ---DPAAIYELVRRKYLPQEYGGTGGNLQDISHTMEAKLSSYGPYFRESQNFGANDKLREFGD 291
               .|..:.:.:.:..:|...||     :.:.:..|..:.....|..|.:...| |:||::.:
  Rat   454 NYQGPGGLVDYLDKDVIPDFLGG-----ESVCNVPEGGMVPKSLYLTEEEQEQA-DQLRQWSE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 13/44 (30%)
SEC14 96..252 CDD:238099 29/193 (15%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 21/105 (20%)
CRAL_TRIO_N 243..288 CDD:215024 13/45 (29%)
CRAL_TRIO 314..477 CDD:306996 26/176 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.